Produktdetails für diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
Übersicht
|
|
| Antigen: | Diaphanous homolog 1 (Drosophila) (DIAPH1) |
| Antikörper-Typ: | Monoklonal |
| Applikation: | ELISA, Western Blotting (WB) |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 97,80 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN197758 |
| Verfügbarkeit: | Ships within 1 day |
Produktbeschreibung: diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
| Antigen | Diaphanous homolog 1 (Drosophila) (DIAPH1) |
| Gen-ID | 1729 |
| Immunogen | DIAPH1 (NP_005210, 921 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGF NISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS* |
| Reaktivität | Human |
| Antikörper-Typ | Monoklonal |
| Isotyp | IgG2b Kappa »Passende Sekundärantikörper |
| Beschreibung | Diaphanous homolog 1 (Drosophila) This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Mouse monoclonal antibody raised against a partial recombinant DIAPH1. Synonyms: DFNA1, DRF1, LFHL1, hDIA1 |
| Klon | 5A8 |
| Wirt | Mouse |
Anwendungen: diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
| Applikation | ELISA, Western Blotting (WB) |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.55 KDa) . |
| Lagerung | Store at -20 |
| Beschränkungen | For Research Use only |
Bilder: diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
|
Western Blot detection against Immunogen (37.55 KDa) .
The detection limit for recombinant GST tagged DIAPH1 is approximately 0.1ng/ml as a capture antibody. |








