PANIER
AIDE
Antigènes
Détail du produit pour diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
Aperçu
|
|
| Antigène: | Diaphanous homolog 1 (Drosophila) (DIAPH1) |
| Type anticorps: | Monoclonal |
| Application: | ELISA, Western Blotting (WB) |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 97,80 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN197758 |
| Disponibilité: | Ships within 1 day |
Description du produit: diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
| Antigène | Diaphanous homolog 1 (Drosophila) (DIAPH1) |
| ID gène | 1729 |
| Immunogène | DIAPH1 (NP_005210, 921 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGF NISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS* |
| Reactivité | Human |
| Type anticorps | Monoclonal |
| Isotype | IgG2b Kappa »Anticorps secondaires correspondants |
| Description | Diaphanous homolog 1 (Drosophila) This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Mouse monoclonal antibody raised against a partial recombinant DIAPH1. Synonyms: DFNA1, DRF1, LFHL1, hDIA1 |
| Clone | 5A8 |
| Hôte | Mouse |
Applications: diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
| Application | ELISA, Western Blotting (WB) |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.55 KDa) . |
| Stock | Store at -20 |
| Restrictions | For Research Use only |
Images: diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
|
Western Blot detection against Immunogen (37.55 KDa) .
The detection limit for recombinant GST tagged DIAPH1 is approximately 0.1ng/ml as a capture antibody. |
