Product details for  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

Overview

Image for diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody
Antigen: Diaphanous homolog 1 (Drosophila) (DIAPH1)
Antibody Type: Monoclonal
Application: ELISA, Western Blotting (WB)
Reactivity: Human
Host: Mouse
Quantity: 20 (Product variants)
Price: 97,80 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN197758
Availability: Ships within 1 day
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Antigen Diaphanous homolog 1 (Drosophila) (DIAPH1)
Gene ID 1729
Immunogen DIAPH1 (NP_005210, 921 a.a. ~ 1025 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QFSEQVENIKPEIVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGF NISFLCKLRDTKSTDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKAS*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2b Kappa »Matching secondary antibodies
Description Diaphanous homolog 1 (Drosophila) This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Mouse monoclonal antibody raised against a partial recombinant DIAPH1. Synonyms: DFNA1, DRF1, LFHL1, hDIA1
Clone 5A8
Host Mouse

Application Details:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Application ELISA, Western Blotting (WB)
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.55 KDa) .
Storage Store at -20
Restrictions For Research Use only

Images:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.55 KDa) .

Image for diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody (1)

The detection limit for recombinant GST tagged DIAPH1 is approximately 0.1ng/ml as a capture antibody.

Image for diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody (2)

External Information:  diaphanous homolog 1 (Drosophila) (DIAPH1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 5A8 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DIAPH1 (Bioinformatic Harvester (EMBL))