Additional Information: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody

Antigen	Dickkopf homolog 1 (Xenopus laevis) (DKK1)
Gene ID	22943
Immunogen	DKK1 (NP_036374, 81 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKN GICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH*
Reactivity	Human, Mouse (Murine), Rat
Antibody Type	Monoclonal
Isotype	IgG2b Kappa »Matching secondary antibodies
Description	Dickkopf homolog 1 (Xenopus laevis) This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Mouse monoclonal antibody raised against a partial recombinant DKK1. Synonyms: DKK-1, SK
Clone	4C10
Host	Mouse

Application Details: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody (1)

The detection limit for recombinant GST tagged DKK1 is approximately 3ng/ml as a capture antibody.

Image for dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody (2)

more...

Google Scholar	Find more references for clone 4C10 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen DKK1 (Bioinformatic Harvester (EMBL))


	Antigen:	Dickkopf homolog 1 (Xenopus laevis) (DKK1)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human, Mouse (Murine), Rat
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN168579
	Availability:	Delivery in 7 to 10 days