PANIER
AIDE
Antigènes
Détail du produit pour dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
Aperçu
|
|
| Antigène: | Dickkopf homolog 1 (Xenopus laevis) (DKK1) |
| Type anticorps: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human, Mouse (Murine), Rat |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 97,80 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN197767 |
| Disponibilité: | Ships within 1 day |
Description du produit: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
| Antigène | Dickkopf homolog 1 (Xenopus laevis) (DKK1) |
| ID gène | 22943 |
| Immunogène | DKK1 (NP_036374, 81 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKN GICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH* |
| Reactivité | Human, Mouse (Murine), Rat |
| Type anticorps | Monoclonal |
| Isotype | IgG2b Kappa »Anticorps secondaires correspondants |
| Description | Dickkopf homolog 1 (Xenopus laevis) This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Mouse monoclonal antibody raised against a partial recombinant DKK1. Synonyms: DKK-1, SK |
| Clone | 4D4 |
| Hôte | Mouse |
Applications: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Stock | Store at -20 |
| Restrictions | For Research Use only |
Images: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) .
The detection limit for recombinant GST tagged DKK1 is approximately 30ng/ml as a capture antibody. |
