Product details for  dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody

Overview

Image for dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
Antigen: Dickkopf homolog 1 (Xenopus laevis) (DKK1)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 20 (Product variants)
Price: 97,80 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN197767
Availability: Ships within 1 day
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody

back to top ^


Antigen Dickkopf homolog 1 (Xenopus laevis) (DKK1)
Gene ID 22943
Immunogen DKK1 (NP_036374, 81 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKN GICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH*
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG2b Kappa »Matching secondary antibodies
Description Dickkopf homolog 1 (Xenopus laevis) This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Mouse monoclonal antibody raised against a partial recombinant DKK1. Synonyms: DKK-1, SK
Clone 4D4
Host Mouse

Application Details:  dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20
Restrictions For Research Use only

Images:  dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody (1)

The detection limit for recombinant GST tagged DKK1 is approximately 30ng/ml as a capture antibody.

Image for dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody (2)

External Information:  dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 4D4 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DKK1 (Bioinformatic Harvester (EMBL))