Product details for dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
Overview
|
|
| Antigen: | Dickkopf homolog 1 (Xenopus laevis) (DKK1) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human, Mouse (Murine), Rat |
| Host: | Mouse |
| Quantity: | |
| Price: | 97,80 € (Plus shipping costs , €10 dry ice fee and VAT) |
| Order number: | ABIN197767 |
| Availability: | Ships within 1 day |
on this page
Customer Service
Additional Information: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
| Antigen | Dickkopf homolog 1 (Xenopus laevis) (DKK1) |
| Gene ID | 22943 |
| Immunogen | DKK1 (NP_036374, 81 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKN GICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH* |
| Reactivity | Human, Mouse (Murine), Rat |
| Antibody Type | Monoclonal |
| Isotype | IgG2b Kappa »Matching secondary antibodies |
| Description | Dickkopf homolog 1 (Xenopus laevis) This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. Mouse monoclonal antibody raised against a partial recombinant DKK1. Synonyms: DKK-1, SK |
| Clone | 4D4 |
| Host | Mouse |
Application Details: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20 |
| Restrictions | For Research Use only |
Images: dickkopf homolog 1 (Xenopus laevis) (DKK1) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) .
The detection limit for recombinant GST tagged DKK1 is approximately 30ng/ml as a capture antibody. |








