BASKET
HELP
Product details for enhancer of zeste homolog 2 (Drosophila) (EZH2) (Human) a...
enhancer of zeste homolog 2 (Drosophila) (EZH2) (Human) antibody
Overview
|
|
| Antigen: | Enhancer of zeste homolog 2 (Drosophila) (EZH2) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN166197 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: enhancer of zeste homolog 2 (Drosophila) (EZH2) (Human) antibody
| Antigen | Enhancer of zeste homolog 2 (Drosophila) (EZH2) |
| Gene ID | 2146 |
| Immunogen | EZH2 (AAH10858, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEI LNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIM * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2b Kappa »Matching secondary antibodies |
| Description | Enhancer of zeste homolog 2 (Drosophila) This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Two transcript variants encoding distinct isoforms have been identified for this gene. Mouse monoclonal antibody raised against a partial recombinant EZH2. Synonyms: ENX-1, EZH1, MGC9169 |
| Clone | 2C3 |
| Host | Mouse |
Application Details: enhancer of zeste homolog 2 (Drosophila) (EZH2) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: enhancer of zeste homolog 2 (Drosophila) (EZH2) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
