Produktdetails für  feline leukemia virus subgroup C cellular receptor (FLVCR...

feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

Übersicht

Bild für feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody
Antigen: Feline leukemia virus subgroup C cellular receptor (FLVCR)
Antikörper-Typ: Monoklonal
Applikation: Western Blotting (WB), ELISA
Reaktivität: Human
Wirt: Mouse
Menge: 100 µg
Preis: 396,00 €   (Zzgl. Versandkosten , €10 Trockeneispauschale sowie MWSt)
Bestellnummer: ABIN168814
Verfügbarkeit: Delivery in 7 to 10 days
Bestellhinweis Bestellhinweis
In den Warenkorb

Auf dieser Seite

Produktbeschreibung
Anwendungen
Bilder
Verwandte Produkte
Weitere Informationen

Kundenservice

Technische Anfrage stellen
Produktdetails an Kollegen senden

Produktbeschreibung:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

zurück nach oben ^


Antigen Feline leukemia virus subgroup C cellular receptor (FLVCR)
Gen-ID 28982
Immunogen FLVCR (NP_054772, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRD SLAAASGVLGGPQTPLAPEEETQARLLP*
Reaktivität Human
Antikörper-Typ Monoklonal
Isotyp IgG2b Kappa »Passende Sekundärantikörper
Beschreibung Feline leukemia virus subgroup C cellular receptor Mouse monoclonal antibody raised against a partial recombinant FLVCR.
Klon 4B2
Wirt Mouse

Anwendungen:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

zurück nach oben ^


Applikation Western Blotting (WB), ELISA
Applikationshinweise Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.24 KDa) .
Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen For Research Use only

Bilder:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

zurück nach oben ^


Western Blot detection against Immunogen (35.24 KDa) .

Bild für feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody (1)

Weitere Informationen:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

zurück nach oben ^


Google Scholar Suchen Sie in Google Scholar™ nach weiteren Artikeln für Klon 4B2
EMBL Harvester Genom von Mensch, Maus oder Ratte nach Antigen FLVCR durchsuchen (Bioinformatic Harvester (EMBL))