BASKET
HELP
Product details for fib (FGFR2) antibody
fib (FGFR2) antibody
Overview
|
|
| Antigen: | Fib (FGFR2) |
| Antibody Type: | Monoclonal |
| Application: | ELISA |
| Quantity: | |
| Price: | 326,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN166233 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: fib (FGFR2) antibody
| Antigen | Fib (FGFR2) |
| Gene ID | 2263 |
| Immunogen | FGFR2 (AAH39243, 621 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLS QPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT* |
| Antibody Type | Monoclonal |
| Isotype | IgG2b »Matching secondary antibodies |
| Description | Fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratinocyte growth factor receptor, craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson-Weiss syndrome) The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized. Mouse monoclonal antibody raised against a partial recombinant FGFR2. Synonyms: BEK, BFR-1, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25 |
| Clone | 3f4 |
Application Details: fib (FGFR2) antibody
| Application | ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein on ELISA |
| Buffer | In 1x PBS, pH 7.2 |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: fib (FGFR2) antibody
|
The detection limit for recombinant GST tagged FGFR2 is approximately 0.1ng/ml as a capture antibody. |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
