You are here: Homepage » Product details for "four and a half LIM domains 1 FHL1 Human"

Product details for four and a half LIM domains 1 (FHL1) (Human) antibody

Print Version

four and a half LIM domains 1 (FHL1) (Human) antibody

Overview


	Antigen:	Four and a half LIM domains 1 (FHL1)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human, Mouse (Murine), Rat
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN166252
	Availability:	Delivery in 7 to 10 days

Antigen	Four and a half LIM domains 1 (FHL1)
Gene ID	2273
Immunogen	FHL1 (NP_001440, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLAN ETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGT*
Reactivity	Human, Mouse (Murine), Rat
Antibody Type	Monoclonal
Isotype	IgG2a Kappa »Matching secondary antibodies
Description	Four and a half LIM domains 1 LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain. Mouse monoclonal antibody raised against a partial recombinant FHL1. Synonyms: FHL1B, KYO-T, MGC111107, SLIM1, bA535K18.1
Clone	2A9
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.89 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (36.89 KDa) .

Image for four and a half LIM domains 1 (FHL1) (Human) antibody (1)

The detection limit for recombinant GST tagged FHL1 is approximately 0.3ng/ml as a capture antibody.

Image for four and a half LIM domains 1 (FHL1) (Human) antibody (2)

Google Scholar	Find more references for clone 2A9 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen FHL1 (Bioinformatic Harvester (EMBL))