Product details for  gap junction protein, beta 1, 32kDa (connexin 32, Charcot...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) (GJB1) (Human) antibody

Overview

Antigen: Gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) (GJB1)
Antibody Type: Monoclonal
Application: ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN166349
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) (GJB1) (Human) antibody

back to top ^


Antigen Gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) (GJB1)
Gene ID 2705
Immunogen GJB1 (AAH22426, 75 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISG TLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCP*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description Gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells (Bergoffen et al., 1993). For a general discussion of connexin proteins, see GJB2 (MIM 121011). Mouse monoclonal antibody raised against a partial recombinant GJB1. Synonyms: CMTX, CMTX1, CX32
Clone 100000000
Host Mouse

Application Details:  gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) (GJB1) (Human) antibody

back to top ^


Application ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 1x PBS, pH 7.2
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

External Information:  gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Tooth neuropathy, X-linked) (GJB1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 100000000 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen GJB1 (Bioinformatic Harvester (EMBL))