Product details for  heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) a...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) antibody

Overview

Image for heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) antibody
Antigen: Heparan sulfate 2-O-sulfotransferase 1 (HS2ST1)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 10 (Product variants)
Price: 63,90 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN197772
Availability: Ships within 1 day
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) antibody

back to top ^


Antigen Heparan sulfate 2-O-sulfotransferase 1 (HS2ST1)
Gene ID 9653
Immunogen HS2ST1 (NP_036394, 130 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYR PGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW*
Reactivity Human
Antibody Type Polyclonal
Description Heparan sulfate 2-O-sulfotransferase 1 Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes heparan sulfate 2-O-sulfotransferase, a member of the heparan sulfate biosynthetic enzyme family. This family member transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Mouse polyclonal antibody raised against a partial recombinant HS2ST1. Synonyms: FLJ11317, KIAA0448, MGC131986, dJ604K5.2
Host Mouse

Application Details:  heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20
Restrictions For Research Use only

Images:  heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) antibody (1)

External Information:  heparan sulfate 2-O-sulfotransferase 1 (HS2ST1) (Human) antibody

back to top ^


Google Scholar Find more references for antigen HS2ST1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen HS2ST1 (Bioinformatic Harvester (EMBL))