kallikrein 10 (KLK10) (Human) antibody

Overview


	Antigen:	Kallikrein 10 (KLK10)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN167190
	Availability:	Delivery in 7 to 10 days

Antigen	Kallikrein 10 (KLK10)
Gene ID	5655
Immunogen	KLK10 (NP_002767, 167 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRG QDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN *
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 lambda »Matching secondary antibodies
Description	Kallikrein 10 Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in two transcript variants encoding the same protein. Mouse monoclonal antibody raised against a partial recombinant KLK10. Synonyms: NES1, PRSSL1
Clone	1G8
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (38.21 KDa) .

Image for kallikrein 10 (KLK10) (Human) antibody (1)

The detection limit for recombinant GST tagged KLK10 is approximately 1ng/ml as a capture antibody.

Image for kallikrein 10 (KLK10) (Human) antibody (2)

Google Scholar	Find more references for clone 1G8 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen KLK10 (Bioinformatic Harvester (EMBL))