BASKET
HELP
Product details for kallikrein 10 (KLK10) (Human) antibody
kallikrein 10 (KLK10) (Human) antibody
Overview
|
|
| Antigen: | Kallikrein 10 (KLK10) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN170971 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: kallikrein 10 (KLK10) (Human) antibody
| Antigen | Kallikrein 10 (KLK10) |
| Gene ID | 5655 |
| Immunogen | KLK10 (NP_002767, 167 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRG QDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN * |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Kallikrein 10 Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded protein is secreted and may play a role in suppression of tumorigenesis in breast and prostate cancers. Alternate splicing of this gene results in two transcript variants encoding the same protein. Mouse polyclonal antibody raised against a partial recombinant KLK10. Synonyms: NES1, PRSSL1 |
| Host | Mouse |
Application Details: kallikrein 10 (KLK10) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: kallikrein 10 (KLK10) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
External Information: kallikrein 10 (KLK10) (Human) antibody
| Google Scholar | Find more references for antigen KLK10 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen KLK10 (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
