Product details for kallikrein 5 (KLK5) (Human) antibody
kallikrein 5 (KLK5) (Human) antibody
Overview
|
|
| Antigen: | Kallikrein 5 (KLK5) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN172312 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: kallikrein 5 (KLK5) (Human) antibody
| Antigen | Kallikrein 5 (KLK5) |
| Gene ID | 25818 |
| Immunogen | KLK5 (NP_036559, 194 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGP VVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Kallikrein 5 Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Mouse polyclonal antibody raised against a partial recombinant KLK5. Synonyms: KLK-L2, KLKL2, SCTE |
| Host | Mouse |
Application Details: kallikrein 5 (KLK5) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: kallikrein 5 (KLK5) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
External Information: kallikrein 5 (KLK5) (Human) antibody
| Google Scholar | Find more references for antigen KLK5 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen KLK5 (Bioinformatic Harvester (EMBL)) |








