Produktdetails für lactase (LCT) (Human) antibody
lactase (LCT) (Human) antibody
Übersicht
|
|
| Antigen: | Lactase (LCT) |
| Antikörper-Typ: | Polyklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 258,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN170587 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: lactase (LCT) (Human) antibody
| Antigen | Lactase (LCT) |
| Gen-ID | 3938 |
| Immunogen | LCT (NP_002290, 32 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AGPLTNDLLHNLSGLLGDQSSNFVAGDKDMYVCHQPLPTFLPEYFSSLHASQITH YKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLKALKTARLQPMV* |
| Reaktivität | Human |
| Antikörper-Typ | Polyklonal |
| Beschreibung | Lactase The protein encoded by this gene belongs to the family 1 of glycosyl hydrolases. The protein is integral to plasma membrane and has both phlorizin hydrolase activity and lactase activity. Mouse polyclonal antibody raised against a partial recombinant LCT. Synonyms: LAC, LPH, LPH1 |
| Wirt | Mouse |
Anwendungen: lactase (LCT) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (36.89 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: lactase (LCT) (Human) antibody
|
Western Blot detection against Immunogen (36.89 KDa) . |
Weitere Informationen: lactase (LCT) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen LCT |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen LCT durchsuchen (Bioinformatic Harvester (EMBL)) |








