PANIER
AIDE
Antigènes
Détail du produit pour mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
Aperçu
|
|
| Antigène: | Mab-21-like 1 (C. elegans) (MAB21L1) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN170614 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
| Antigène | Mab-21-like 1 (C. elegans) (MAB21L1) |
| ID gène | 4081 |
| Immunogène | MAB21L1 (NP_005575, 250 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) CLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGIL LQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEK* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | Mab-21-like 1 (C. elegans) This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Mouse polyclonal antibody raised against a partial recombinant MAB21L1. Synonyms: CAGR1, FLJ10197, Nbla00126 |
| Hôte | Mouse |
Applications: mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.10 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
|
Western Blot detection against Immunogen (38.10 KDa) . |
Informations supplémentaires: mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène MAB21L1 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène MAB21L1 (Bioinformatic Harvester (EMBL)) |
