myosin IIIA (MYO3A) (Human) antibody

Overview


	Antigen:	Myosin IIIA (MYO3A)
	Antibody Type:	Monoclonal
	Application:	ELISA, Western Blotting (WB)
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN168985
	Availability:	Delivery in 7 to 10 days

Antigen	Myosin IIIA (MYO3A)
Gene ID	53904
Immunogen	MYO3A (NP_059129, 1400 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQ LKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG2a Kappa »Matching secondary antibodies
Description	Myosin IIIA The protein encoded by this gene belongs to the myosin superfamily. Myosins are actin-dependent motor proteins and are categorized into conventional myosins (class II) and unconventional myosins (classes I and III through XV) based on their variable C-terminal cargo-binding domains. Class III myosins, such as this one, have a kinase domain N-terminal to the conserved N-terminal motor domains and are expressed in photoreceptors. The protein encoded by this gene plays an important role in hearing in humans. 3 different recessive, loss of function mutations in the encoded protein have been shown to cause nonsyndromic progressive hearing loss. Expression of this gene is highly restricted, with the strongest expression in retina and cochlea. Mouse monoclonal antibody raised against a partial recombinant MYO3A. Synonyms: DFNB30
Clone	5A12
Host	Mouse

Application	ELISA, Western Blotting (WB)
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (31.25 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (31.25 KDa) .

Image for myosin IIIA (MYO3A) (Human) antibody (1)

The detection limit for recombinant GST tagged MYO3A is approximately 0.3ng/ml as a capture antibody.

Image for myosin IIIA (MYO3A) (Human) antibody (2)

Google Scholar	Find more references for clone 5A12 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen MYO3A (Bioinformatic Harvester (EMBL))