Product details for  peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human)...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody

Overview

Image for peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody
Antigen: Peptidylprolyl isomerase G (cyclophilin G) (PPIG)
Antibody Type: Monoclonal
Application: Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
Reactivity: Human
Host: Mouse
Quantity: 20 (Product variants)
Price: 97,80 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN197766
Availability: Ships within 1 day
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody

back to top ^


Antigen Peptidylprolyl isomerase G (cyclophilin G) (PPIG)
Gene ID 9360
Immunogen PPIG (NP_004783, 13 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHR VVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNK*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description Peptidylprolyl isomerase G (cyclophilin G) Mouse monoclonal antibody raised against a partial recombinant PPIG. Synonyms: CARS-Cyp, CYP, MGC133241, SRCyp
Clone 4F8
Host Mouse

Application Details:  peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody

back to top ^


Application Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.45 KDa) .
Storage Store at -20
Restrictions For Research Use only

Images:  peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.45 KDa) .

Image for peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to PPIG (H00009360-M02) on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Image for peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody (2)

The detection limit for recombinant GST tagged PPIG is approximately 0.1ng/ml as a capture antibody.

Image for peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody (3)

External Information:  peptidylprolyl isomerase G (cyclophilin G) (PPIG) (Human) antibody

back to top ^


Google Scholar Find more references for clone 4F8 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen PPIG (Bioinformatic Harvester (EMBL))