Sie sind hier: Startseite » Produktdetails für "phosphatase orphan 1 PHOSPHO1 Human"

Produktdetails für phosphatase, orphan 1 (PHOSPHO1) (Human) antibody

Druckversion

phosphatase, orphan 1 (PHOSPHO1) (Human) antibody

Übersicht


	Antigen:	Phosphatase, orphan 1 (PHOSPHO1)
	Antikörper-Typ:	Monoklonal
	Applikation:	Western Blotting (WB), ELISA
	Reaktivität:	Human, Mouse (Murine), Rat
	Wirt:	Mouse
	Menge:	100 µg
	Preis:	396,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt)
	Bestellnummer:	ABIN169631
	Verfügbarkeit:	Delivery in 7 to 10 days

Antigen	Phosphatase, orphan 1 (PHOSPHO1)
Gen-ID	162466
Immunogen	PHOSPHO1 (NP_848595, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFP RRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS*
Reaktivität	Human, Mouse (Murine), Rat
Antikörper-Typ	Monoklonal
Isotyp	IgG1 Kappa »Passende Sekundärantikörper
Beschreibung	Phosphatase, orphan 1 Mouse monoclonal antibody raised against a partial recombinant PHOSPHO1.
Klon	4B2
Wirt	Mouse

Applikation	Western Blotting (WB), ELISA
Applikationshinweise	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) .
Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen	For Research Use only

Western Blot detection against Immunogen (37.00 KDa) .

Bild für phosphatase, orphan 1 (PHOSPHO1) (Human) antibody (1)

The detection limit for recombinant GST tagged PHOSPHO1 is approximately 1ng/ml as a capture antibody.

Bild für phosphatase, orphan 1 (PHOSPHO1) (Human) antibody (2)

Google Scholar	Suchen Sie in Google Scholar™ nach weiteren Artikeln für Klon 4B2
EMBL Harvester	Genom von Mensch, Maus oder Ratte nach Antigen PHOSPHO1 durchsuchen (Bioinformatic Harvester (EMBL))