PANIER
AIDE
Antigènes
Détail du produit pour phosphatase, orphan 1 (PHOSPHO1) (Human) antibody
phosphatase, orphan 1 (PHOSPHO1) (Human) antibody
Aperçu
|
|
| Antigène: | Phosphatase, orphan 1 (PHOSPHO1) |
| Type anticorps: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human, Mouse (Murine), Rat |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 396,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN169631 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: phosphatase, orphan 1 (PHOSPHO1) (Human) antibody
| Antigène | Phosphatase, orphan 1 (PHOSPHO1) |
| ID gène | 162466 |
| Immunogène | PHOSPHO1 (NP_848595, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFP RRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS* |
| Reactivité | Human, Mouse (Murine), Rat |
| Type anticorps | Monoclonal |
| Isotype | IgG1 Kappa »Anticorps secondaires correspondants |
| Description | Phosphatase, orphan 1 Mouse monoclonal antibody raised against a partial recombinant PHOSPHO1. |
| Clone | 4B2 |
| Hôte | Mouse |
Applications: phosphatase, orphan 1 (PHOSPHO1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: phosphatase, orphan 1 (PHOSPHO1) (Human) antibody
|
Western Blot detection against Immunogen (37.00 KDa) .
The detection limit for recombinant GST tagged PHOSPHO1 is approximately 1ng/ml as a capture antibody. |
