Product details for  phosphatase, orphan 1 (PHOSPHO1) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

phosphatase, orphan 1 (PHOSPHO1) (Human) antibody

Overview

Image for phosphatase, orphan 1 (PHOSPHO1) (Human) antibody
Antigen: Phosphatase, orphan 1 (PHOSPHO1)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN169631
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  phosphatase, orphan 1 (PHOSPHO1) (Human) antibody

back to top ^


Antigen Phosphatase, orphan 1 (PHOSPHO1)
Gene ID 162466
Immunogen PHOSPHO1 (NP_848595, 168 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) CARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFP RRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKS*
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG1 Kappa »Matching secondary antibodies
Description Phosphatase, orphan 1 Mouse monoclonal antibody raised against a partial recombinant PHOSPHO1.
Clone 4B2
Host Mouse

Application Details:  phosphatase, orphan 1 (PHOSPHO1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  phosphatase, orphan 1 (PHOSPHO1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for phosphatase, orphan 1 (PHOSPHO1) (Human) antibody (1)

The detection limit for recombinant GST tagged PHOSPHO1 is approximately 1ng/ml as a capture antibody.

Image for phosphatase, orphan 1 (PHOSPHO1) (Human) antibody (2)

External Information:  phosphatase, orphan 1 (PHOSPHO1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 4B2 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen PHOSPHO1 (Bioinformatic Harvester (EMBL))