Product details for pleckstrin homology-like domain, family A, member 2 (PHLD...
pleckstrin homology-like domain, family A, member 2 (PHLDA2) (Human) antibody
Overview
|
|
| Antigen: | Pleckstrin homology-like domain, family A, member 2 (PHLDA2) |
| Antibody Type: | Monoclonal |
| Application: | ELISA, Western Blotting (WB) |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN167649 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: pleckstrin homology-like domain, family A, member 2 (PHLDA2) (Human) antibody
| Antigen | Pleckstrin homology-like domain, family A, member 2 (PHLDA2) |
| Gene ID | 7262 |
| Immunogen | PHLDA2 (NP_003302, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSI LKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDF * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | Pleckstrin homology-like domain, family A, member 2 This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Studies of the mouse gene, however, which is also located in an imprinted gene domain, have shown that the product of this gene regulates placental growth. Mouse monoclonal antibody raised against a partial recombinant PHLDA2. Synonyms: BRW1C, BWR1C, HLDA2, IPL, TSSC3 |
| Clone | 5000 |
| Host | Mouse |
Application Details: pleckstrin homology-like domain, family A, member 2 (PHLDA2) (Human) antibody
| Application | ELISA, Western Blotting (WB) |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: pleckstrin homology-like domain, family A, member 2 (PHLDA2) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) .
The detection limit for recombinant GST tagged PHLDA2 is approximately 0.3ng/ml as a capture antibody. |
External Information: pleckstrin homology-like domain, family A, member 2 (PHLDA2) (Human) antibody
| Google Scholar | Find more references for clone 5000 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen PHLDA2 (Bioinformatic Harvester (EMBL)) |








