Product details for pleiotrophin (heparin binding growth factor 8, neurite gr...
pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) (PTN) (Human) antibody
Overview
|
|
| Antigen: | Pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) (PTN) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 97,80 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN197761 |
| Availability: | Ships within 1 day |
Additional Information: pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) (PTN) (Human) antibody
| Antigen | Pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) (PTN) |
| Gene ID | 5764 |
| Immunogen | PTN (NP_002816, 45 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAEC KYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | Pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) Mouse monoclonal antibody raised against a partial recombinant PTN. Synonyms: HARP, HBGF8, HBNF, NEGF1 |
| Clone | 5C3 |
| Host | Mouse |
Application Details: pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) (PTN) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20 |
| Restrictions | For Research Use only |
Images: pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) (PTN) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) .
Immunoperoxidase of monoclonal antibody to PTN (H00005764-M01) on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
The detection limit for recombinant GST tagged PTN is approximately 10ng/ml as a capture antibody. |
Product variants
| pleiotrophin (heparin binding growth factor 8, neurite growth-promoting factor 1) (PTN) (Human)... |








