Product details for  runt-related transcription factor 1 (acute myeloid leukem...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody

Overview

Image for runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody
Antigen: Runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN165819
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody

back to top ^


Antigen Runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1)
Gene ID 861
Immunogen RUNX1 (NP_001001890, 210 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSI ASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2b Kappa »Matching secondary antibodies
Description Runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Two transcript variants encoding different isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant RUNX1. Synonyms: AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2A2, PEBP2aB
Clone 3A1
Host Mouse

Application Details:  runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.22 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.22 KDa) .

Image for runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody (1)

External Information:  runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 3A1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen RUNX1 (Bioinformatic Harvester (EMBL))