Product details for runt-related transcription factor 1 (acute myeloid leukem...
runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody
Overview
|
|
| Antigen: | Runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human, Mouse (Murine), Rat |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165821 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody
| Antigen | Runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) |
| Gene ID | 861 |
| Immunogen | RUNX1 (NP_001001890, 210 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSI ASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFP* |
| Reactivity | Human, Mouse (Murine), Rat |
| Antibody Type | Monoclonal |
| Isotype | IgG2b Kappa »Matching secondary antibodies |
| Description | Runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Two transcript variants encoding different isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant RUNX1. Synonyms: AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2A2, PEBP2aB |
| Clone | 40000000 |
| Host | Mouse |
Application Details: runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.22 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody
|
Western Blot detection against Immunogen (37.22 KDa) .
Immunoperoxidase of monoclonal antibody to RUNX1 (H00000861-M05) on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
The detection limit for recombinant GST tagged RUNX1 is approximately 1ng/ml as a capture antibody. |
External Information: runt-related transcription factor 1 (acute myeloid leukemia 1, aml1 oncogene) (RUNX1) (Human) antibody
| Google Scholar | Find more references for clone 40000000 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen RUNX1 (Bioinformatic Harvester (EMBL)) |








