Product details for  runt-related transcription factor 1, translocated to, 1 (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1) (Human) antibody

Overview

Image for runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1) (Human) antibody
Antigen: Runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1)
Antibody Type: Monoclonal
Application: ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN165822
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1) (Human) antibody

back to top ^


Antigen Runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1)
Gene ID 862
Immunogen RUNX1T1 (NP_004340, 416 a.a. ~ 526 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQA AEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG *
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description Runt-related transcription factor 1, translocated to, 1 (cyclin D-related) The protein encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8,21)(q22,q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant RUNX1T1. Synonyms: AML1T1, CBFA2T1, CDR, ETO, MGC2796, MTG8, MTG8b, ZMYND2
Clone 5A12
Host Mouse

Application Details:  runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1) (Human) antibody

back to top ^


Application ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 1x PBS, pH 7.2
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1) (Human) antibody

back to top ^


The detection limit for recombinant GST tagged RUNX1T1 is approximately 0.3ng/ml as a capture antibody.

Image for runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1) (Human) antibody (1)

External Information:  runt-related transcription factor 1, translocated to, 1 (cyclin D-related) (RUNX1T1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 5A12 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen RUNX1T1 (Bioinformatic Harvester (EMBL))