Product details for runt-related transcription factor 2 (RUNX2) (Human) antibody
runt-related transcription factor 2 (RUNX2) (Human) antibody
Overview
|
|
| Antigen: | Runt-related transcription factor 2 (RUNX2) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165818 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: runt-related transcription factor 2 (RUNX2) (Human) antibody
| Antigen | Runt-related transcription factor 2 (RUNX2) |
| Gene ID | 860 |
| Immunogen | RUNX2 (NP_004339, 251 a.a. ~ 351 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTT PLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG Mix Kappa »Matching secondary antibodies |
| Description | Runt-related transcription factor 2 This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing. Mouse monoclonal antibody raised against a partial recombinant RUNX2. Synonyms: AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1 |
| Clone | 1D8 |
| Host | Mouse |
Application Details: runt-related transcription factor 2 (RUNX2) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: runt-related transcription factor 2 (RUNX2) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) .
Immunoperoxidase of monoclonal antibody to RUNX2 (H00000860-M01) on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
The detection limit for recombinant GST tagged RUNX2 is approximately 0.03ng/ml as a capture antibody. |








