You are here: Homepage » Product details for "runtrelated transcription factor 2 RUNX2 Human"

Product details for runt-related transcription factor 2 (RUNX2) (Human) antibody

Print Version

runt-related transcription factor 2 (RUNX2) (Human) antibody

Overview


	Antigen:	Runt-related transcription factor 2 (RUNX2)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl (Product variants)
	Price:	258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN169915
	Availability:	Delivery in 7 to 10 days

Antigen	Runt-related transcription factor 2 (RUNX2)
Gene ID	860
Immunogen	RUNX2 (NP_004339, 251 a.a. ~ 351 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTT PLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA*
Reactivity	Human
Antibody Type	Polyclonal
Description	Runt-related transcription factor 2 This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing. Mouse polyclonal antibody raised against a partial recombinant RUNX2. Synonyms: AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for runt-related transcription factor 2 (RUNX2) (Human) antibody (1)

Google Scholar	Find more references for antigen RUNX2 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen RUNX2 (Bioinformatic Harvester (EMBL))