Produktdetails für septin 9 (SEPT9) (Human) antibody
septin 9 (SEPT9) (Human) antibody
Übersicht
|
|
| Antigen: | Septin 9 (SEPT9) |
| Antikörper-Typ: | Polyklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 63,90 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN197773 |
| Verfügbarkeit: | Ships within 1 day |
Produktbeschreibung: septin 9 (SEPT9) (Human) antibody
| Antigen | Septin 9 (SEPT9) |
| Gen-ID | 10801 |
| Immunogen | SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGP KAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP |
| Reaktivität | Human |
| Antikörper-Typ | Polyklonal |
| Beschreibung | Septin 9 Mouse polyclonal antibody raised against a partial recombinant SEPT9. Synonyms: AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SINT1 |
| Wirt | Mouse |
Anwendungen: septin 9 (SEPT9) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (34.00 KDa) . |
| Lagerung | Store at -20 |
| Beschränkungen | For Research Use only |
Bilder: septin 9 (SEPT9) (Human) antibody
|
Western Blot detection against Immunogen (34.00 KDa) . |
Weitere Informationen: septin 9 (SEPT9) (Human) antibody
| Google Scholar | Suchen Sie in Google Scholar™ nach weiteren Artikeln für Antigen Sep 09 |
| EMBL Harvester | Genom von Mensch, Maus oder Ratte nach Antigen Sep 09 durchsuchen (Bioinformatic Harvester (EMBL)) |








