PANIER
AIDE
Antigènes
Détail du produit pour septin 9 (SEPT9) (Human) antibody
septin 9 (SEPT9) (Human) antibody
Aperçu
|
|
| Antigène: | Septin 9 (SEPT9) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 63,90 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN197773 |
| Disponibilité: | Ships within 1 day |
Description du produit: septin 9 (SEPT9) (Human) antibody
| Antigène | Septin 9 (SEPT9) |
| ID gène | 10801 |
| Immunogène | SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGP KAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | Septin 9 Mouse polyclonal antibody raised against a partial recombinant SEPT9. Synonyms: AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SINT1 |
| Hôte | Mouse |
Applications: septin 9 (SEPT9) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (34.00 KDa) . |
| Stock | Store at -20 |
| Restrictions | For Research Use only |
Images: septin 9 (SEPT9) (Human) antibody
|
Western Blot detection against Immunogen (34.00 KDa) . |
Informations supplémentaires: septin 9 (SEPT9) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène Sep 09 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène Sep 09 (Bioinformatic Harvester (EMBL)) |
