Product details for  septin 9 (SEPT9) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

septin 9 (SEPT9) (Human) antibody

Overview

Image for septin 9 (SEPT9) (Human) antibody
Antigen: Septin 9 (SEPT9)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 10 (Product variants)
Price: 63,90 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN197773
Availability: Ships within 1 day

Additional Information:  septin 9 (SEPT9) (Human) antibody

back to top ^


Antigen Septin 9 (SEPT9)
Gene ID 10801
Immunogen SEPT9 (AAH21192, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGP KAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTP
Reactivity Human
Antibody Type Polyclonal
Description Septin 9 Mouse polyclonal antibody raised against a partial recombinant SEPT9. Synonyms: AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SINT1
Host Mouse

Application Details:  septin 9 (SEPT9) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (34.00 KDa) .
Storage Store at -20
Restrictions For Research Use only

Images:  septin 9 (SEPT9) (Human) antibody

back to top ^


Western Blot detection against Immunogen (34.00 KDa) .

Image for septin 9 (SEPT9) (Human) antibody (1)

External Information:  septin 9 (SEPT9) (Human) antibody

back to top ^


Google Scholar Find more references for antigen Sep 09 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen Sep 09 (Bioinformatic Harvester (EMBL))