Product details for  solute carrier family 11 (proton-coupled divalent metal i...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody

Overview

Image for solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody
Antigen: Solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2)
Antibody Type: Monoclonal
Application: Immunohistochemistry (IHC), Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN166955
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody

back to top ^


Antigen Solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2)
Gene ID 4891
Immunogen SLC11A2 (NP_000608, 1 a.a. ~ 66 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKI SIPEEEYSCF*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description Solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 Mouse monoclonal antibody raised against a partial recombinant SLC11A2. Synonyms: DCT1, DMT1, NRAMP2
Clone 4C6
Host Mouse

Application Details:  solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody

back to top ^


Application Immunohistochemistry (IHC), Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (33.26 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody

back to top ^


Western Blot detection against Immunogen (33.26 KDa) .

Image for solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to SLC11A2 (H00004891-M01) on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3ug/ml]

Image for solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody (2)

External Information:  solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 (SLC11A2) (Human) antibody

back to top ^


Google Scholar Find more references for clone 4C6 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen SLC11A2 (Bioinformatic Harvester (EMBL))