BASKET
HELP
Product details for toll-like receptor 6 (TLR6) (Human) antibody
toll-like receptor 6 (TLR6) (Human) antibody
Overview
|
|
| Antigen: | Toll-like receptor 6 (TLR6) |
| Antibody Type: | Monoclonal |
| Application: | ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN168322 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: toll-like receptor 6 (TLR6) (Human) antibody
| Antigen | Toll-like receptor 6 (TLR6) |
| Gene ID | 10333 |
| Immunogen | TLR6 (NP_006059, 201 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFT LNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | Toll-like receptor 6 The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins. Mouse monoclonal antibody raised against a partial recombinant TLR6. |
| Clone | 40000 |
| Host | Mouse |
Application Details: toll-like receptor 6 (TLR6) (Human) antibody
| Application | ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein on ELISA |
| Buffer | In 1x PBS, pH 7.2 |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: toll-like receptor 6 (TLR6) (Human) antibody
|
The detection limit for recombinant GST tagged TLR6 is approximately 0.03ng/ml as a capture antibody. |
External Information: toll-like receptor 6 (TLR6) (Human) antibody
| Google Scholar | Find more references for clone 40000 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen TLR6 (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
