Product details for  translocase of outer mitochondrial membrane 22 homolog (y...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody

Overview

Image for translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody
Antigen: Translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl (Product variants)
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN172763
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody

back to top ^


Antigen Translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22)
Gene ID 56993
Immunogen TOMM22 (NP_064628, 12 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGAT FDLSLFVAQKMYRFSRAA*
Reactivity Human
Antibody Type Polyclonal
Description Translocase of outer mitochondrial membrane 22 homolog (yeast) The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. Mouse polyclonal antibody raised against a partial recombinant TOMM22. Synonyms: 1C9-2, MST065, MSTP065, TOM22
Host Mouse

Application Details:  translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (34.14 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody

back to top ^


Western Blot detection against Immunogen (34.14 KDa) .

Image for translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody (1)

External Information:  translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody

back to top ^


Google Scholar Find more references for antigen TOMM22 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen TOMM22 (Bioinformatic Harvester (EMBL))