Product details for translocase of outer mitochondrial membrane 22 homolog (y...
translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody
Overview
|
|
| Antigen: | Translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN172763 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody
| Antigen | Translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) |
| Gene ID | 56993 |
| Immunogen | TOMM22 (NP_064628, 12 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGAT FDLSLFVAQKMYRFSRAA* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Translocase of outer mitochondrial membrane 22 homolog (yeast) The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. Mouse polyclonal antibody raised against a partial recombinant TOMM22. Synonyms: 1C9-2, MST065, MSTP065, TOM22 |
| Host | Mouse |
Application Details: translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (34.14 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody
|
Western Blot detection against Immunogen (34.14 KDa) . |
Product variants
External Information: translocase of outer mitochondrial membrane 22 homolog (yeast) (TOMM22) (Human) antibody
| Google Scholar | Find more references for antigen TOMM22 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen TOMM22 (Bioinformatic Harvester (EMBL)) |








