Product details for ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)...
ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) (Human) antibody
Overview
|
|
| Antigen: | Ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 63,90 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN197774 |
| Availability: | Ships within 1 day |
Additional Information: ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) (Human) antibody
| Antigen | Ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) |
| Gene ID | 51465 |
| Immunogen | UBE2J1 (-, 9 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIV LPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGF * |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system. Mouse polyclonal antibody raised against a partial recombinant UBE2J1. Synonyms: CGI-76, HSPC153, HSPC205, HSU93243, MGC12555, NCUBE1, Ubc6p |
| Host | Mouse |
Application Details: ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20 |
| Restrictions | For Research Use only |
Images: ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
Product variants
| ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) (Human) antibody (Quantity:... |
| ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) (Human) antibody (Quantity: 50... |
External Information: ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1) (Human) antibody
| Google Scholar | Find more references for antigen UBE2J1 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen UBE2J1 (Bioinformatic Harvester (EMBL)) |








