BASKET
HELP
Product details for v-abl Abelson murine leukemia viral oncogene homolog 2 (a...
v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) (ABL2) (Human) antibody
Overview
|
|
| Antigen: | V-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) (ABL2) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165536 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) (ABL2) (Human) antibody
| Antigen | V-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) (ABL2) |
| Gene ID | 27 |
| Immunogen | ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQL ERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | V-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) ABL2 is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. ABL2 is expressed in both normal and tumor cells. The ABL2 gene product is expressed as two variants bearing different amino termini, both approximately 12-kb in length. Mouse monoclonal antibody raised against a partial recombinant ABL2. Synonyms: ABLL, ARG |
| Clone | 2H8 |
| Host | Mouse |
Application Details: v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) (ABL2) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (34.00 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) (ABL2) (Human) antibody
|
Western Blot detection against Immunogen (34.00 KDa) . |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
