Product details for  zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) an...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody

Overview

Image for zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody
Antigen: Zinc finger protein 131 (Klon pHZ-10) (ZNF131)
Antibody Type: Monoclonal
Application: ELISA, Western Blotting (WB)
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN167745
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody

back to top ^


Antigen Zinc finger protein 131 (Klon pHZ-10) (ZNF131)
Gene ID 7690
Immunogen ZNF131 (AAH35875, 139 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQH LNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHT*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description Zinc finger protein 131 (clone pHZ-10) Mouse monoclonal antibody raised against a partial recombinant ZNF131. Synonyms: pHZ-10
Clone 5F1
Host Mouse

Application Details:  zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody

back to top ^


Application ELISA, Western Blotting (WB)
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody (1)

The detection limit for recombinant GST tagged ZNF131 is approximately 0.3ng/ml as a capture antibody.

Image for zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody (2)

External Information:  zinc finger protein 131 (Klon pHZ-10) (ZNF131) (Human) antibody

back to top ^


Google Scholar Find more references for clone 5F1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ZNF131 (Bioinformatic Harvester (EMBL))