Product details for LIM homeobox 2 (LHX2) (Human) antibody
LIM homeobox 2 (LHX2) (Human) antibody
Overview
|
|
| Antigen: | LIM homeobox 2 (LHX2) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN171737 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: LIM homeobox 2 (LHX2) (Human) antibody
| Antigen | LIM homeobox 2 (LHX2) |
| Gene ID | 9355 |
| Immunogen | LHX2 (NP_004780, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAG CGGKISDRYYLLAVDKQWHMR* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | LIM homeobox 2 This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. Mouse polyclonal antibody raised against a partial recombinant LHX2. Synonyms: LH2, MGC138390, hLhx2 |
| Host | Mouse |
Application Details: LIM homeobox 2 (LHX2) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (34.47 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: LIM homeobox 2 (LHX2) (Human) antibody
|
Western Blot detection against Immunogen (34.47 KDa) . |
External Information: LIM homeobox 2 (LHX2) (Human) antibody
| Google Scholar | Find more references for antigen LHX2 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen LHX2 (Bioinformatic Harvester (EMBL)) |








