Product details for  feline leukemia virus subgroup C cellular receptor (FLVCR...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

Overview

Image for feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody
Antigen: Feline leukemia virus subgroup C cellular receptor (FLVCR)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs and VAT)
Order number: ABIN168814
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Antigen Feline leukemia virus subgroup C cellular receptor (FLVCR)
Gene ID 28982
Immunogen FLVCR (NP_054772, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRD SLAAASGVLGGPQTPLAPEEETQARLLP*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2b Kappa
Description Feline leukemia virus subgroup C cellular receptor Mouse monoclonal antibody raised against a partial recombinant FLVCR.
Clone 4B2
Host Mouse
Secondary Antibodies Chicken anti-Mouse (Murine) IgG, Donkey anti-Mouse (Murine) IgG, Goat anti-Mouse (Murine) IgG, Mouse anti-Mouse (Murine) IgG, Rabbit anti-Mouse (Murine) IgG, Rat anti-Mouse (Murine) IgG, Sheep anti-Mouse (Murine) IgG

Application Details:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.24 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Western Blot detection against Immunogen (35.24 KDa) .

Image for feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody (1)

External Information:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Google Scholar Find more references for clone 4B2 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen FLVCR (Bioinformatic Harvester (EMBL))