Product details for  feline leukemia virus subgroup C cellular receptor (FLVCR...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

Overview

Image for feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody
Antigen: Feline leukemia virus subgroup C cellular receptor (FLVCR)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs and VAT)
Order number: ABIN168814
Availability: Delivery in 7 to 10 days

Additional Information:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Antigen Feline leukemia virus subgroup C cellular receptor (FLVCR)
Gene ID 28982
Immunogen FLVCR (NP_054772, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRD SLAAASGVLGGPQTPLAPEEETQARLLP*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2b Kappa
Description Feline leukemia virus subgroup C cellular receptor Mouse monoclonal antibody raised against a partial recombinant FLVCR.
Clone 4B2
Host Mouse
Secondary Antibodies Chicken anti-Mouse (Murine) IgG, Donkey anti-Mouse (Murine) IgG, Goat anti-Mouse (Murine) IgG, Mouse anti-Mouse (Murine) IgG, Rabbit anti-Mouse (Murine) IgG, Rat anti-Mouse (Murine) IgG, Sheep anti-Mouse (Murine) IgG

Application Details:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.24 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Western Blot detection against Immunogen (35.24 KDa) .

Image for feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody (1)

External Information:  feline leukemia virus subgroup C cellular receptor (FLVCR) (Human) antibody

back to top ^


Google Scholar Find more references for clone 4B2 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen FLVCR (Bioinformatic Harvester (EMBL))