Product details for kynureninase (L-kynurenine hydrolase) (KYNU) (Human) anti...
kynureninase (L-kynurenine hydrolase) (KYNU) (Human) antibody
Overview
|
|
| Antigen: | Kynureninase (L-kynurenine hydrolase) (KYNU) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN171666 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: kynureninase (L-kynurenine hydrolase) (KYNU) (Human) antibody
| Antigen | Kynureninase (L-kynurenine hydrolase) (KYNU) |
| Gene ID | 8942 |
| Immunogen | KYNU (NP_003928, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPP VDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRP* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Kynureninase (L-kynurenine hydrolase) Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant KYNU. |
| Host | Mouse |
Application Details: kynureninase (L-kynurenine hydrolase) (KYNU) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.88 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: kynureninase (L-kynurenine hydrolase) (KYNU) (Human) antibody
|
Western Blot detection against Immunogen (37.88 KDa) . |
External Information: kynureninase (L-kynurenine hydrolase) (KYNU) (Human) antibody
| Google Scholar | Find more references for antigen KYNU on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen KYNU (Bioinformatic Harvester (EMBL)) |








