anti-Human Calpain S1 antibody for Immunofluorescence

Recommended Calpain S1 Antibody (supplied by: Log in to see )

Antigen
Calpain, Small Subunit 1 (CAPNS1) Antibodies
  • CAPNS1
  • MGC84330
  • 30K
  • CALPAIN4
  • CANP
  • CANPS
  • CAPN4
  • CDPS
  • CSS1
  • Capn4
  • Capa-4
  • Capa4
  • D7Ertd146e
  • calpain, small subunit 1
  • CAPNS1
  • capns1
  • Capns1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
39
13
12
3
2
2
1
1
1
1
1
1
Host
Rabbit
25
14
Clonality
Polyclonal
Conjugate
This Calpain S1 antibody is un-conjugated
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
30
13
11
9
7
6
4
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4287346
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.326117 ABIN560162 IF IHC (p) RNAi ELISA WB Mouse IgG1 kappa AA 172-260, partial Log in to see 3C4 3
12.326117 ABIN4287347 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN395902 IF WB Mouse IgG1 kappa AA 172-260 Log in to see 3C4
1 ABIN598500 IF ELISA WB Mouse IgG1, kappa AA 172-260 Log in to see 3C4
1 ABIN5075474 ELISA FACS ICC IF WB Mouse IgG1 kappa AA 84-268 Log in to see 1D11
1 ABIN5075475 ELISA FACS ICC IF WB Mouse IgG1 kappa AA 84-268 Log in to see 1D11
1 ABIN5540248 EIA FACS ICC IF WB Mouse IgG1 AA 84-268 Log in to see AT1D11
1 ABIN5540249 EIA FACS ICC IF WB Mouse IgG1 AA 84-268 Log in to see AT1D11
1 ABIN2218141 IF IHC ELISA WB Mouse IgG1 kappa AA 172-260 Log in to see 3C4

Top referenced anti-Calpain S1 antibody for Immunofluorescence

Similar anti-Calpain S1 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 4 Antibodies 5 Antibodies 13 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 3 Antibodies 7 Antibodies
Immunofluorescence (IF) 2 Antibodies 3 Antibodies 10 Antibodies
Immunohistochemistry (IHC) 9 Antibodies 9 Antibodies 12 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies 1 Antibodies
Western Blotting (WB) 12 Antibodies 13 Antibodies
Flow Cytometry (FACS) 2 Antibodies 4 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies

General

Antigen Calpain, Small Subunit 1 (CAPNS1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(39), (13), (12), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(25), (14)
Clonality
Polyclonal
Conjugate This Calpain S1 antibody is un-conjugated
(1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(30), (13), (11), (9), (7), (6), (4), (3), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Calpain S1 Antibody

Target Details Calpain S1 Application Details Handling ProductDetails: References for anti-Calpain S1 antibody (ABIN4287346) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:THYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPG
Isotype IgG

Target Details Calpain S1

Product Details anti-Calpain S1 Antibody Application Details Handling ProductDetails: References for anti-Calpain S1 antibody (ABIN4287346) Images back to top
Antigen
Alternative Name Calpain Small Subunit 1 (CAPNS1 Antibody Abstract)
Background Gene Symbol: CAPNS1
Gene ID 826
Pathways Apoptosis

Application Details

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Handling ProductDetails: References for anti-Calpain S1 antibody (ABIN4287346) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Application Details ProductDetails: References for anti-Calpain S1 antibody (ABIN4287346) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-Calpain S1 antibody (ABIN4287346)

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Application Details Handling Images back to top
Product cited in:

Wang, Palme, Rotter, Schilcher, Cukaj, Wang, Ladurner, Heiss, Stangl, Dirsch, Atanasov: "Piperine inhibits ABCA1 degradation and promotes cholesterol efflux from THP-1-derived macrophages." in: Molecular nutrition & food research, 2016 (Sample species: Human).

Images

Product Details anti-Calpain S1 Antibody Target Details Calpain S1 Application Details Handling ProductDetails: References for anti-Calpain S1 antibody (ABIN4287346) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calpain S1 antibody (Calpain, Small Subunit 1) (ABIN4287346) Immunohistochemistry-Paraffin: Calpain small subunit 1 Antibody [NBP1-90329] - Staini...
Immunofluorescence (IF) image for anti-Calpain S1 antibody (Calpain, Small Subunit 1) (ABIN4287346) Immunocytochemistry/Immunofluorescence: Calpain small subunit 1 Antibody [NBP1-90329]...
Western Blotting (WB) image for anti-Calpain S1 antibody (Calpain, Small Subunit 1) (ABIN4287346) Western Blot: Calpain small subunit 1 Antibody [NBP1-90329] - Lane 1: NIH-3T3 cell ly...
Western Blotting (WB) image for anti-Calpain S1 antibody (Calpain, Small Subunit 1) (ABIN4287346) Western Blot: Calpain small subunit 1 Antibody [NBP1-90329] - Lane 1: Marker [kDa] 23...