anti-Human CD11b antibody for Immunochromatography

Recommended CD11b Antibody (supplied by: Log in to see )

Antigen
Integrin alpha M (ITGAM) Antibodies
  • CD11b/CD18
  • CR3
  • CR3A
  • Cd11b
  • F730045J24Rik
  • Ly-40
  • MAC1
  • Mac-1
  • Mac-1a
  • CD11B
  • MAC-1
  • MAC1A
  • MO1A
  • SLEB6
  • C3bi
  • integrin, alpha M (complement component 3 receptor 3 subunit)
  • integrin alpha M
  • integrin, alpha M
  • ITGAM
  • Itgam
Epitope
AA 301-451
49
24
21
19
16
15
15
13
7
6
6
5
5
5
4
4
4
4
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Reactivity
Human
691
474
192
78
31
19
17
15
13
11
9
9
7
7
5
4
4
4
2
2
Host
Rabbit
495
371
163
16
5
2
Clonality
Polyclonal
Conjugate
This CD11b antibody is un-conjugated
147
119
88
48
20
19
15
15
14
14
13
11
10
9
9
9
8
8
7
7
7
6
6
6
6
4
4
4
3
3
3
2
2
2
2
2
2
2
2
2
2
2
1
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
844
235
227
173
167
139
95
95
94
67
25
21
21
13
8
6
5
4
4
3
3
1
1
1
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2295636
$ 614.43
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2292239 IC ELISA WB Mouse AA 623-728 Log in to see 14i174

Similar anti-CD11b Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 3 Antibodies
Blocking Antibody (Inhibition) 1 Antibodies
Blocking Reagent (BR) 17 Antibodies
Cytometry by Time of Flight (CyTOF) 6 Antibodies
ELISA 77 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 541 Antibodies
Functional Studies (Func) 61 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 84 Antibodies
Immunofluorescence (IF) 122 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 10 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 25 Antibodies
Immunohistochemistry (IHC) 123 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 11 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 119 Antibodies

General

Antigen Integrin alpha M (ITGAM) Antibodies
Epitope AA 301-451
(49), (24), (21), (19), (16), (15), (15), (13), (7), (6), (6), (5), (5), (5), (4), (4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(691), (474), (192), (78), (31), (19), (17), (15), (13), (11), (9), (9), (7), (7), (5), (4), (4), (4), (2), (2)
Host Rabbit
(495), (371), (163), (16), (5), (2)
Clonality
Polyclonal
Conjugate This CD11b antibody is un-conjugated
(147), (119), (88), (48), (20), (19), (15), (15), (14), (14), (13), (11), (10), (9), (9), (9), (8), (8), (7), (7), (7), (6), (6), (6), (6), (4), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(844), (235), (227), (173), (167), (139), (95), (95), (94), (67), (25), (21), (21), (13), (8), (6), (5), (4), (4), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CD11b Antibody

Target Details CD11b Application Details Handling Images
Sequence MRNKKFELGL EFPNLPYYID GDVKLTQSMA IIRYIADKHN MLGGCPKERA EISMLEGAVL DIRYGVSRIA YSKDFETLKV DFLSKLPEML KMFEDRLCHK TYLNGDHVTH PDFMLYDALD VVLYMDPMCL DAFPKLVCFK KRIEAIPQID KYLKSSKYIA WPLQGWQATF GGGDHPPKSD GSTSGSGHHH HHHSAGLVPR GSTAIGMKET AAAKFERQHM DSPDLGTLEV LFQGPLGSEF -NTIASKPPRD HVFQVNNFEA LKTIQNQLRE KIFAIEGTQT GSSSSFEHEM SQEGFSAAIT SNGPLLSTVG SYDWAGGVFL YTSKEKSTFI NMTRVDSDMN DAYLGYAAAI ILRNRVQSLV LGAPRYQHIG LVAMFRQNTG MWESNANVKG T
Cross-Reactivity Human
Cross-Reactivity (Details) Calculated cross reactivity: Hu
Characteristics Integrin Alpha M (ITGaM, ITG-AM, CD11b, CD11B, CR3A, MAC-1, MAC1A, MO1A, Complement Component 3 Receptor 3 Subunit)
Purification Purified by immunoaffinity chromatography.
Immunogen ITGaM (Asn301~Thr451), MRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTLEVLFQGPLGSEF-NTIASKPPRD HVFQVNNFEA LKTIQNQLRE KIFAIEGTQT GSSSSFEHEM SQEGFSAAIT SNGPLLSTVG SYDWAGGVFL YTSKEKSTFI NMTRVDSDMN DAYLGYAAAI ILRNRVQSLV LGAPRYQHIG LVAMFRQNTG MWESNANVKG T
Isotype IgG

Target Details CD11b

Product Details anti-CD11b Antibody Application Details Handling Images back to top
Antigen
Alternative Name Integrin alpha M (ITGAM Antibody Abstract)
Pathways Apoptosis, Activation of Innate immune Response, Toll-Like Receptors Cascades, Activated T Cell Proliferation

Application Details

Product Details anti-CD11b Antibody Target Details CD11b Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-CD11b Antibody Target Details CD11b Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C