You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human GZMA antibody for Western Blotting

Recommended GZMA Antibody (supplied by: Log in to see )

Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) Antibodies
  • gzmA
  • GZMA
  • AW494114
  • Ctla-3
  • Ctla3
  • Hf
  • SE1
  • TSP-1
  • TSP1
  • CTLA3
  • HFSP
  • granzyme A
  • Granzyme A
  • granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
  • gzmA
  • GZMA
  • graa
  • Gzma
This GZMA antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4316050
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0741942 ABIN2785887 WB Rabbit C-Term Log in to see Polyclonal
3.0741942 ABIN3044452 IHC (p) WB Rabbit IgG AA 175-190, Middle Region Log in to see Polyclonal
3.0741942 ABIN1859107 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 29-262 Log in to see Polyclonal
3.0741942 ABIN4316052 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
3.0741942 ABIN3222898 IC IF IHC WB Rabbit Log in to see Polyclonal
3.0741942 ABIN1882358 IHC WB Rabbit IgG Log in to see Polyclonal
3.0741942 ABIN2487322 WB Rabbit IgG Log in to see Polyclonal
3.0741942 ABIN928746 WB Rabbit C-Term Log in to see Polyclonal
3.0741942 ABIN3031103 IHC (p) WB Rabbit IgG Middle Region Log in to see Polyclonal
3.0741942 ABIN3015050 IHC WB Rabbit Log in to see Polyclonal
1 ABIN2774086 WB Rabbit Middle Region Log in to see Polyclonal 1
1 ABIN119562 IHC (p) WB Mouse IgG1 Log in to see GA6 1
1 ABIN322156 WB Rabbit IgG AA 110-159 Log in to see Polyclonal
1 ABIN575874 WB Rabbit C-Term Log in to see Polyclonal
1 ABIN205475 FACS IHC (p) IP WB Mouse IgG1 Log in to see CB9
1 ABIN2464400 ELISA WB Goat Internal Region Log in to see Polyclonal
1 ABIN153566 IHC (p) IHC WB Mouse IgG1 Log in to see GA6
1 ABIN742335 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN1838151 IHC (p) WB Mouse IgG1 Log in to see GA6
1 ABIN2621678 IHC (p) WB Rabbit IgG AA 175-190 Log in to see Polyclonal

Top referenced anti-GZMA antibody for Western Blotting

Similar anti-GZMA Antibodies

Application / Reactivity Human
ELISA 28 Antibodies
ELISA (Capture) 1 Antibodies
Flow Cytometry (FACS) 26 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 3 Antibodies
Immunofluorescence (IF) 5 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 20 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 19 Antibodies
Immunoprecipitation (IP) 5 Antibodies
Mass Cytometry (CyTOF) 1 Antibodies
Western Blotting (WB) 44 Antibodies


Antigen Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) Antibodies
Reactivity Human
(105), (31), (21), (2), (1), (1), (1), (1)
Host Rabbit
(56), (46), (13)
Conjugate This GZMA antibody is un-conjugated
(6), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(50), (34), (28), (24), (19), (13), (6), (5), (4), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-GZMA Antibody

Target Details GZMA Application Details Handling References for anti-GZMA Antibody (ABIN4316050) Images
Purification Immunogen affinity purified
Immunogen Synthetic peptides corresponding to GZMA(granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)) The peptide sequence was selected from the middle region of GZMA (NP_006135). Peptide sequence TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGT

Target Details GZMA

Product Details anti-GZMA Antibody Application Details Handling References for anti-GZMA Antibody (ABIN4316050) Images back to top
Alternative Name Granzyme A (GZMA Antibody Abstract)
Background Gene Symbol: GZMA
Molecular Weight Theoretical MW: 29 kDa
Gene ID 3001
UniProt P12544
Research Area Adaptive Immunity, Immunology, Innate Immunity, Cell/Tissue Markers, Apoptosis/Necrosis
Pathways Apoptosis

Application Details

Product Details anti-GZMA Antibody Target Details GZMA Handling References for anti-GZMA Antibody (ABIN4316050) Images back to top
Application Notes Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against GZMA and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-GZMA Antibody Target Details GZMA Application Details References for anti-GZMA Antibody (ABIN4316050) Images back to top
Format Lyophilized
Reconstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1 mg/mL. Vortex followed by Centrifuge again to pellet the solution.
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

References for anti-GZMA Antibody (ABIN4316050)

Product Details anti-GZMA Antibody Target Details GZMA Application Details Handling Images back to top
Product cited in:

Bem, Bos, Bots, Wolbink, van Ham, Medema, Lutter, van Woensel: "Activation of the granzyme pathway in children with severe respiratory syncytial virus infection." in: Pediatric research, Vol. 63, Issue 6, pp. 650-5, 2008


Product Details anti-GZMA Antibody Target Details GZMA Application Details Handling References for anti-GZMA Antibody (ABIN4316050) back to top
Supplier Images
Western Blotting (WB) image for anti-GZMA antibody (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3)) (ABIN4316050) Western Blot: Granzyme A Antibody [NBP1-58993] - HEK293T, Antibody Dilution: 0.2 ug/ml.
Western Blotting (WB) image for anti-GZMA antibody (Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3)) (ABIN4316050) Western Blot: Granzyme A Antibody [NBP1-58993] - Jurkat cell lysate, concentration 0....