anti-Human TNFRSF10C antibody for Immunochromatography

Recommended TNFRSF10C Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor Receptor Superfamily, Member 10c, Decoy Without An Intracellular Domain (TNFRSF10C) Antibodies
  • CD263
  • DCR1
  • DCR1-TNFR
  • LIT
  • TRAIL-R3
  • TRAILR3
  • TRID
  • TNFRSF10C
  • tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
  • TNFRSF10C
Reactivity
Human
164
18
15
7
Host
Goat
121
48
3
2
Clonality
Polyclonal
Conjugate
This TNFRSF10C antibody is un-conjugated
20
14
6
6
5
5
3
3
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
Application
Immunochromatography (IC), Flow Cytometry (FACS), ELISA, Western Blotting (WB)
101
75
31
23
17
12
7
6
3
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN2379279
$ 586.14
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2379299 IC FACS Mouse IgG1 Log in to see HS301

General

Antigen Tumor Necrosis Factor Receptor Superfamily, Member 10c, Decoy Without An Intracellular Domain (TNFRSF10C) Antibodies
Reactivity Human
(164), (18), (15), (7)
Host Goat
(121), (48), (3), (2)
Clonality
Polyclonal
Conjugate This TNFRSF10C antibody is un-conjugated
(20), (14), (6), (6), (5), (5), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunochromatography (IC), Flow Cytometry (FACS), ELISA, Western Blotting (WB)
(101), (75), (31), (23), (17), (12), (7), (6), (3), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-TNFRSF10C Antibody

Target Details TNFRSF10C Application Details Handling Images
Sequence EVPQQTVAPQ QQRHSFKGEE CPAGSHRSEH TC
Cross-Reactivity Human
Cross-Reactivity (Details) Calculated cross reactivity: Hu
Characteristics TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3)
Purification Purified by immunoaffinity chromatography.
Immunogen Synthetic peptide (EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC) corresponding to the extracellular domain sequence of human TRAIL-R3.
Isotype IgG

Target Details TNFRSF10C

Product Details anti-TNFRSF10C Antibody Application Details Handling Images back to top
Antigen
Alternative Name TRAIL Receptor 3 (TNFRSF10C Antibody Abstract)
NCBI Accession NP_003801
Pathways Apoptosis

Application Details

Product Details anti-TNFRSF10C Antibody Target Details TNFRSF10C Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-TNFRSF10C Antibody Target Details TNFRSF10C Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide before the addition of 40 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C