You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human TNFRSF10C antibody for Immunochromatography

Recommended TNFRSF10C Antibody (supplied by: Log in to see )

Tumor Necrosis Factor Receptor Superfamily, Member 10c, Decoy Without An Intracellular Domain (TNFRSF10C) Antibodies
  • CD263
  • DCR1
  • LIT
  • TRAIL-R3
  • TRID
  • tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
This TNFRSF10C antibody is un-conjugated
Immunochromatography (IC), Flow Cytometry (FACS), ELISA, Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2379279
$ 564.14
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2379299 IC FACS Mouse IgG1 Log in to see HS301

Similar anti-TNFRSF10C Antibodies

Application / Reactivity Human
Cytometry by Time of Flight (CyTOF) 1 Antibodies
ELISA 13 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 90 Antibodies
Functional Studies (Func) 2 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 10 Antibodies
Immunofluorescence (IF) 6 Antibodies
Immunohistochemistry (IHC) 15 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2 Antibodies
Immunoprecipitation (IP) 5 Antibodies
Western Blotting (WB) 49 Antibodies


Antigen Tumor Necrosis Factor Receptor Superfamily, Member 10c, Decoy Without An Intracellular Domain (TNFRSF10C) Antibodies
Reactivity Human
(136), (12), (8), (7)
Host Goat
(94), (46), (4), (2)
Conjugate This TNFRSF10C antibody is un-conjugated
(20), (15), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), Flow Cytometry (FACS), ELISA, Western Blotting (WB)
(89), (58), (20), (15), (10), (6), (5), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-TNFRSF10C Antibody

Target Details TNFRSF10C Application Details Handling Images
Cross-Reactivity Human
Cross-Reactivity (Details) Calculated cross reactivity: Hu
Characteristics TRAIL Receptor 3 (TRAIL R3, TNF-Related Apoptosis Inducing Receptor3)
Purification Purified by immunoaffinity chromatography.
Immunogen Synthetic peptide (EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC) corresponding to the extracellular domain sequence of human TRAIL-R3.
Isotype IgG

Target Details TNFRSF10C

Product Details anti-TNFRSF10C Antibody Application Details Handling Images back to top
Alternative Name TRAIL Receptor 3 (TNFRSF10C Antibody Abstract)
NCBI Accession NP_003801
Pathways Apoptosis

Application Details

Product Details anti-TNFRSF10C Antibody Target Details TNFRSF10C Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only


Product Details anti-TNFRSF10C Antibody Target Details TNFRSF10C Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 1 mg/mL BSA, 0.09 % sodium azide before the addition of 40 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C