Product details for  5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Huma...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Human) antibody

Overview

Image for 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Human) antibody
Antigen: 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170454
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Human) antibody

back to top ^


Antigen 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B)
Gene ID 3357
Immunogen HTR2B (NP_000858, 1 a.a. ~ 57 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLH W*
Reactivity Human
Antibody Type Polyclonal
Description 5-hydroxytryptamine (serotonin) receptor 2B Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets, central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens. Mouse polyclonal antibody raised against a partial recombinant HTR2B. Synonyms: 5-HT(2B), 5-HT2B
Host Mouse

Application Details:  5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (32.27 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Human) antibody

back to top ^


Western Blot detection against Immunogen (32.27 KDa) .

Image for 5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Human) antibody (1)

External Information:  5-hydroxytryptamine (serotonin) receptor 2B (HTR2B) (Human) antibody

back to top ^


Google Scholar Find more references for antigen HTR2B on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen HTR2B (Bioinformatic Harvester (EMBL))