Product details for  5-methyltetrahydrofolate-homocysteine methyltransferase (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) (Human) antibody

Overview

Image for 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) (Human) antibody
Antigen: 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170678
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) (Human) antibody

back to top ^


Antigen 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR)
Gene ID 4548
Immunogen MTR (NP_000245, 1094 a.a. ~ 1204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRE LWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL *
Reactivity Human
Antibody Type Polyclonal
Description 5-methyltetrahydrofolate-homocysteine methyltransferase MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Mouse polyclonal antibody raised against a partial recombinant MTR.
Host Mouse

Application Details:  5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) (Human) antibody

back to top ^


Western Blot detection against Immunogen (38.21 KDa) .

Image for 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) (Human) antibody (1)

External Information:  5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) (Human) antibody

back to top ^


Google Scholar Find more references for antigen MTR on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen MTR (Bioinformatic Harvester (EMBL))