Product details for  A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody

Overview

Image for A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody
Antigen: A kinase (PRKA) anchor protein 10 (AKAP10)
Antibody Type: Monoclonal
Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN168532
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody

back to top ^


Antigen A kinase (PRKA) anchor protein 10 (AKAP10)
Gene ID 11216
Immunogen AKAP10 (NP_009133, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQK STKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA*
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description A kinase (PRKA) anchor protein 10 The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA, therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction. Mouse monoclonal antibody raised against a partial recombinant AKAP10. Synonyms: D-AKAP2, MGC9414, PRKA10
Clone 8C10
Host Mouse

Application Details:  A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody

back to top ^


Application Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.74 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.74 KDa) .

Image for A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to AKAP10 (H00011216-M04) on formalin-fixed paraffin-embedded human testis. [antibody concentration 0 ug/ml]

Image for A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody (2)

The detection limit for recombinant GST tagged AKAP10 is approximately 0.03ng/ml as a capture antibody.

Image for A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody (3)

External Information:  A kinase (PRKA) anchor protein 10 (AKAP10) (Human) antibody

back to top ^


Google Scholar Find more references for clone 8C10 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen AKAP10 (Bioinformatic Harvester (EMBL))