You are here: Homepage » Product details for "A kinase PRKA anchor protein 11 AKAP11 Human"

Product details for A kinase (PRKA) anchor protein 11 (AKAP11) (Human) antibody

Print Version

A kinase (PRKA) anchor protein 11 (AKAP11) (Human) antibody

Overview


	Antigen:	A kinase (PRKA) anchor protein 11 (AKAP11)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN172154
	Availability:	Delivery in 7 to 10 days

Antigen	A kinase (PRKA) anchor protein 11 (AKAP11)
Gene ID	11215
Immunogen	AKAP11 (NP_057332, 1801 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFML LSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA*
Reactivity	Human
Antibody Type	Polyclonal
Description	A kinase (PRKA) anchor protein 11 The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed at high levels throughout spermatogenesis and in mature sperm. It binds the RI and RII subunits of PKA in testis. It may serve a function in cell cycle control of both somatic cells and germ cells in addition to its putative role in spermatogenesis and sperm function. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Mouse polyclonal antibody raised against a partial recombinant AKAP11. Synonyms: AKAP220, DKFZp781I12161, FLJ11304, KIAA0629, PRKA11
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (37.22 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.22 KDa) .

Image for A kinase (PRKA) anchor protein 11 (AKAP11) (Human) antibody (1)

Google Scholar	Find more references for antigen AKAP11 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen AKAP11 (Bioinformatic Harvester (EMBL))