Product details for  ARP1 actin-related protein 1 homolog A, centractin alpha ...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody

Overview

Image for ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody
Antigen: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN171896
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody

back to top ^


Antigen ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A)
Gene ID 10121
Immunogen ACTR1A (NP_005727, 279 a.a. ~ 376 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAP QERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT*
Reactivity Human
Antibody Type Polyclonal
Description ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. Mouse polyclonal antibody raised against a partial recombinant ACTR1A. Synonyms: ARP1
Host Mouse

Application Details:  ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.78 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.78 KDa) .

Image for ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody (1)

External Information:  ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody

back to top ^


Google Scholar Find more references for antigen ACTR1A on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ACTR1A (Bioinformatic Harvester (EMBL))